2.50 Rating by CuteStat

amargidergi.com is 1 decade 1 year old. It is a domain having com extension. It has a global traffic rank of #9446032 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, amargidergi.com is SAFE to browse.

PageSpeed Score
0
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 89
Daily Pageviews: 178

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: 566
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: 1,370
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 9,446,032
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

94.199.200.87

Hosted Country:

Türkiye TR

Location Latitude:

41.0484

Location Longitude:

29.0156
Amargi Dergi | 3 aylık Feminist Dergi

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: Not Applicable H2 Headings: 10
H3 Headings: 19 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 28
Google Adsense: Not Applicable Google Analytics: UA-46182829-1

Websites Hosted on Same IP (i.e. 94.199.200.87)

Kayseri Evden Eve Nakliyat | Kayseri Ev Taşıma firmaları

- kayserievdenevenakliyatfirmalari.com

Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.

8,137,110 $ 240.00

Index of /

- mersindoguakdeniztemsilciligi.com
Not Applicable $ 8.95

vBulletin 4.2.0 Install System

- audiclubtr.com
Not Applicable $ 8.95

Özcanlar Mermer Granit | Yapı Malzemeleri

- ozcanlarmermergranit.com

Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi

Not Applicable $ 8.95

Twins Park Residence

- twinsparkresidence.com
Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Connection: close
X-Powered-By: PHP/5.3.29
X-Pingback: http://www.amargidergi.com/yeni/xmlrpc.php
Content-Type: text/html; charset=UTF-8
Etag: "16991-1576165177;gz"
X-LiteSpeed-Cache: hit
Content-Encoding: gzip
Vary: Accept-Encoding
Content-Length: 20670
Date: Sat, 14 Dec 2019 16:04:13 GMT

Domain Information

Domain Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registration Date: May 14, 2012, 5:24 PM 1 decade 1 year 11 months ago
Expiration Date: May 14, 2020, 5:24 PM 3 years 11 months 2 weeks ago
Domain Status:
clienttransferprohibited

Domain Nameserver Information

Host IP Address Country
ns01.data24.net 37.230.110.110 Türkiye Türkiye
ns02.data24.net 37.230.111.111 Türkiye Türkiye

DNS Record Analysis

Host Type TTL Extra
amargidergi.com A 10799 IP: 94.199.200.87
amargidergi.com NS 86400 Target: cpns2.turdns.com
amargidergi.com NS 86400 Target: cpns1.turdns.com
amargidergi.com SOA 10800 MNAME: cpns1.turdns.com
RNAME: csf.ofis.net
Serial: 2018081608
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
amargidergi.com MX 14400 Priority: 10
Target: mail.amargidergi.com
amargidergi.com TXT 14400 TXT: v=spf1 include:_spf.trwww.com -all

Similarly Ranked Websites

Taylor Law Offices L.L.C – Just another WordPress site

- johntaylorlegalservices.com
9,446,033 $ 8.95

Allweb | Home

- allweb.com.kh

ALLWEB is one of the leading Cambodian IT companies since 2004. We are specialized in offshore software development, and also aim to address emerging needs in Cambodia as its companies are growing fast: our goal is to participate in the emergence of a local high-end software development market. Our customers range from

9,446,044 $ 240.00

Butterfly Online-Store

- butterflymag.com

Table Tennis for you - der offizielle Butterfly Online-Store. Beläge, Hölzer, Textilien, Tische und Zubehör - alle Butterflyprodukte unter einer Adresse.

9,446,053 $ 240.00

Domain Default page

- dyingbyte.online
9,446,057 $ 240.00

Coming Soon

- halk-hizmet.site
9,446,062 $ 240.00

Full WHOIS Lookup

Domain Name: AMARGIDERGI.COM
Registry Domain ID: 1720276970_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.aerotek.com.tr
Registrar URL:
Updated Date: 2019-07-14T02:15:51Z
Creation Date: 2012-05-14T11:39:27Z
Registrar Registration Expiration Date: 2020-05-14T11:39:27Z
Registrar: Aerotek Bilisim Sanayi ve Ticaret AS
Registrar IANA ID: 1534
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: haktan ural
Registrant Organization:
Registrant Street: Yasamkent Mah Atasehir Sit 2/5 Cayyolu
Registrant City: Ankara
Registrant State/Province: TR
Registrant Postal Code: 06810
Registrant Country: TR
Registrant Phone: +90.03122417950
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: haktanural@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: haktan ural
Admin Organization:
Admin Street: Yasamkent Mah Atasehir Sit 2/5 Cayyolu
Admin City: Ankara
Admin State/Province: TR
Admin Postal Code: 06810
Admin Country: TR
Admin Phone: +90.03122417950
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: haktanural@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: haktan ural
Tech Organization:
Tech Street: Yasamkent Mah Atasehir Sit 2/5 Cayyolu
Tech City: Ankara
Tech State/Province: TR
Tech Postal Code: 06810
Tech Country: TR
Tech Phone: +90.03122417950
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: haktanural@gmail.com
Name Server: ns01.data24.net
Name Server: ns02.data24.net
DNSSEC: Unsigned
Registrar Abuse Contact Email: logicbox@aerotek.com.tr
Registrar Abuse Contact Phone: +90.2623245555
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-14T16:04:19Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Registration Service Provided By: DATA24 - INTERNET ILETISIM TEKNOLOJILERI

The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is Aerotek Bilisim Sanayi ve Ticaret AS.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.